DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32939 and Nat8

DIOPT Version :9

Sequence 1:NP_788618.1 Gene:CG32939 / 318260 FlyBaseID:FBgn0052939 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_072157.1 Gene:Nat8 / 64570 RGDID:621609 Length:222 Species:Rattus norvegicus


Alignment Length:212 Identity:38/212 - (17%)
Similarity:71/212 - (33%) Gaps:52/212 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RDY-----IMSFSNKSFFVYCFREITLQFIVITWAIFFIFLGVPLLFCA-----LTVPACIFCLF 77
            |||     :.|...|......||.     :::......:.|||||....     |....|||.|.
  Rat    12 RDYEQVVDMFSRGMKEHIPTAFRH-----LLLLPRTLLLLLGVPLALVLVSGSWLLAVVCIFFLL 71

  Fly    78 TGTYFSFYSKAVELMRTKPSQSLVAECYEPFIFRCSPKEASYQIFTENCPYEETY---------T 133
            ...:|         :..:|.::.|::|                :.|:.....::|         .
  Rat    72 PFLWF---------LAGQPWKNYVSKC----------------LHTDMADITKSYLSDRGSGFWV 111

  Fly   134 RKFRRRI---VAAISVKNHHAVYNAAWIYRFAIDPHYPCQTIMDPMIKLVVKNCIIGGYASLECT 195
            .:...:|   |.|:.||:..:......::|.::...:..|.|...:::.|::.....||..:...
  Rat   112 AESGGQIVGTVGALPVKDPPSGRKQLQLFRLSVSSQHRGQGIAKALVRTVLQFARDQGYTDVVLV 176

  Fly   196 ISEWQESERDFYDDFGF 212
            ....|:.....|...||
  Rat   177 TGLLQQGAVTLYYSMGF 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32939NP_788618.1 None
Nat8NP_072157.1 hydrophobic domain 43..78 11/43 (26%)
RimI <101..201 CDD:223532 16/93 (17%)
NAT_SF 109..175 CDD:173926 11/65 (17%)
N-acetyltransferase consensus motif D 109..124 2/14 (14%)
N-acetyltransferase consensus motif A 134..169 4/34 (12%)
N-acetyltransferase consensus motif B 177..197 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.