DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32939 and Nat8f1

DIOPT Version :9

Sequence 1:NP_788618.1 Gene:CG32939 / 318260 FlyBaseID:FBgn0052939 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_038964231.1 Gene:Nat8f1 / 59300 RGDID:621606 Length:255 Species:Rattus norvegicus


Alignment Length:232 Identity:42/232 - (18%)
Similarity:80/232 - (34%) Gaps:60/232 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQPFIVIRNYTQDDELKCQEL----VRDYIMSFSNKSFFVYCFREITLQFIVITWAIFFIFLGVP 61
            |.|: .||.|...|.....::    :.::|.|              |.:.:::......:.||||
  Rat    11 MAPY-HIRQYQDSDHKSVVDVFTKGMEEHIPS--------------TFRHMLMLPRTLLLLLGVP 60

  Fly    62 LLFCALTVPA-----CIFCLFTGTYFSFYSKAVELMRTKPSQSLVAECYEPFIFRCSPKEASYQI 121
            |   ||.:.:     .:.|:|      |....:..:..:|.:..||.|                :
  Rat    61 L---ALVLVSGSWLLAVVCIF------FLLLLLRFLAGQPWKEYVATC----------------L 100

  Fly   122 FTENCPYEETYTRKFRR-----------RIVAAISVKNHHAVYNAAWIYRFAIDPHYPCQTIMDP 175
            .|:.....::|......           .||||:.||:..:......::|.::...:..|.|...
  Rat   101 RTDMADITKSYLNAHGSFWVAESGNQVVGIVAALPVKDPPSGRKQLQLFRLSVSSQHRGQGIAKA 165

  Fly   176 MIKLVVKNCIIGGYASLECTISEWQESERDFYDDFGF 212
            :::.|::.....||..:....|..|:.....|...||
  Rat   166 LVRTVLQFARDQGYTDVVLETSTLQQGAMTLYLGMGF 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32939NP_788618.1 None
Nat8f1XP_038964231.1 Acetyltransf_1 92..202 CDD:395465 20/125 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.