DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32939 and nat8l

DIOPT Version :9

Sequence 1:NP_788618.1 Gene:CG32939 / 318260 FlyBaseID:FBgn0052939 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001077308.1 Gene:nat8l / 564754 ZFINID:ZDB-GENE-030729-4 Length:282 Species:Danio rerio


Alignment Length:216 Identity:40/216 - (18%)
Similarity:84/216 - (38%) Gaps:37/216 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVIRNYTQDDELKCQELVRDYIMSFSNKSFFVYCFREITLQFI--VITWAIFFIFLGVPLLFCAL 67
            :.||.:.:.|..:.:.:..:.||.....|.|....::.|.||:  .:|...:.:.....|.||| 
Zfish    58 VFIREFERSDHEEVRRIFNEGIMERIPNSAFRGLKQQTTTQFMYAFLTVMCYVMTKSFTLTFCA- 121

  Fly    68 TVPACIFCLFTGTYFSFYSKAVEL------MRTKPSQSLVAECYEPFIFRCSPKEASYQIFTENC 126
              |   |.|....|  :||:.|.|      :.|..:..                ||.|...|.:|
Zfish   122 --P---FILMGARY--YYSRKVILSYLDCALHTDMADI----------------EAYYMKPTGSC 163

  Fly   127 PYEETYTRKFRRRIVAAISVKNHHAVYNAAWIYRFAIDPHYPCQTIMDPMIKLVVKNCIIGGYAS 191
                .:....:.::|..::.::... .|...:.|.::|.|:..:.|...:.:.|::..::..|::
Zfish   164 ----FWVAVLQGQVVGIVAAQSRED-DNTVELRRMSVDSHFRGKGIAKALGRRVIEFAMLNNYSA 223

  Fly   192 LECTISEWQESERDFYDDFGF 212
            :....:..:.:....|:..||
Zfish   224 VVLGTTAVKMAAHKLYESLGF 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32939NP_788618.1 None
nat8lNP_001077308.1 Acetyltransf_1 171..245 CDD:278980 11/75 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.