DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32939 and Nat8l

DIOPT Version :9

Sequence 1:NP_788618.1 Gene:CG32939 / 318260 FlyBaseID:FBgn0052939 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001178610.1 Gene:Nat8l / 289727 RGDID:1305719 Length:299 Species:Rattus norvegicus


Alignment Length:218 Identity:37/218 - (16%)
Similarity:76/218 - (34%) Gaps:41/218 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVIRNYTQDDELKCQELVRDYIMS-FSNKSFFVYCFREITLQFIVITWAIFFIFLGVPLLFCALT 68
            :.||.:...::...:.:..|.|:. ..|.:|........|.....:..|:.|......||.|  .
  Rat    75 VCIREFRAAEQEAARRIFYDGILERIPNTAFRGLRQHPRTQLLYALLAALCFAVTRSLLLTC--L 137

  Fly    69 VPACIFCLFTGTYFSFYSKAVELMRTKPSQSLVAECYEPFIFRCSPKEASYQIFTENCPYEETYT 133
            |||.:..|   .|  :||:.|.|        ...||               .:.|:....|:.|.
  Rat   138 VPAGLLAL---RY--YYSRKVIL--------AYLEC---------------ALHTDMADIEQYYM 174

  Fly   134 RK---------FRRRIVAAISVKNHHAVYNAAWIYRFAIDPHYPCQTIMDPMIKLVVKNCIIGGY 189
            :.         ....:|..::.:.|.. .|...:.|.::|..:..:.|...:.:.|::..::..|
  Rat   175 KPPGSCFWVAVLDGNVVGIVAARAHEE-DNTVELLRMSVDSRFRGKGIAKALGRRVLEFAMLHNY 238

  Fly   190 ASLECTISEWQESERDFYDDFGF 212
            :::....:..:.:....|:..||
  Rat   239 SAVVLGTTAVKVAAHKLYESLGF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32939NP_788618.1 None
Nat8lNP_001178610.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..70
Acetyltransf_1 151..261 CDD:395465 16/133 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.