DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32939 and Nat8f5

DIOPT Version :9

Sequence 1:NP_788618.1 Gene:CG32939 / 318260 FlyBaseID:FBgn0052939 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_543160.1 Gene:Nat8f5 / 114020 RGDID:621610 Length:227 Species:Rattus norvegicus


Alignment Length:224 Identity:41/224 - (18%)
Similarity:71/224 - (31%) Gaps:55/224 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IRNYTQDDELKCQELVRDYIMSFSN--KSFFVYCFREITLQFIVITWAIFFIFLGVPLLFCA--- 66
            ||.|.:.|.....:|       ||:  |......||    ..:::...:.|:| ..||....   
  Rat     6 IRQYQERDHKHVVDL-------FSSGIKEHIPAAFR----YTLLLPKTLLFLF-AAPLTIVLASG 58

  Fly    67 --LTVPACIFCLFTGTYFSFYSKAVELMRTKPSQSLVAECYEPFIFRCSPKEASYQIFTENCPYE 129
              |....|||         |....:..:..:|.:..||.|.:                |:.....
  Rat    59 SWLLAVVCIF---------FLLLLLRFLAGQPFKEYVAMCLQ----------------TDMADIT 98

  Fly   130 ETYTRKFRR-----------RIVAAISVKNHHAVYNAAWIYRFAIDPHYPCQTIMDPMIKLVVKN 183
            ::|......           .||||:.||...:......::..::......|.|...:::.|::.
  Rat    99 KSYLNAHGSFWVAESGGQVVGIVAALPVKESPSGRKQLQLFHLSVSSQCRGQGIAKALVRTVLQF 163

  Fly   184 CIIGGYASLECTISEWQESERDFYDDFGF 212
            ....||..:....|..|:.....|:..||
  Rat   164 ARDQGYMDVVLETSIIQQGAMTLYEAMGF 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32939NP_788618.1 None
Nat8f5NP_543160.1 RimI <101..196 CDD:223532 17/92 (18%)
NAT_SF 108..175 CDD:173926 11/66 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.