DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32939 and Nat8f6

DIOPT Version :9

Sequence 1:NP_788618.1 Gene:CG32939 / 318260 FlyBaseID:FBgn0052939 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001188318.1 Gene:Nat8f6 / 100504710 MGIID:3779382 Length:226 Species:Mus musculus


Alignment Length:260 Identity:50/260 - (19%)
Similarity:88/260 - (33%) Gaps:65/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQPFIVIRNYTQDDELKCQELVR----DYIMSFSNKSFFVYCFREITLQFIVITWAIFFIFLGVP 61
            |.|: .||.|...|.....:|.|    ::|.:              |.:.:::......:.||||
Mouse     1 MAPY-HIRKYQDSDHRSVVDLFRRGMEEHIPA--------------TFRHMLLLPRTLLLLLGVP 50

  Fly    62 L-LFCA----LTVPACIFCLFTGTYFSFYSKAVELMRTKPSQSLVAECYEPFIFRCSPKEASYQI 121
            | ||.|    |.|...|..||...:|                 |....:|..:..|        :
Mouse    51 LTLFLASGSWLLVLLSILTLFLSLWF-----------------LAKYTWEKHVMNC--------L 90

  Fly   122 FTENCPYEETY------------TRKFRRRIVAAISVKNHHAVYNAAWIYRFAIDPHYPCQTIMD 174
            .|:......||            :|.....:|||..||:.........:...::...:..:.:..
Mouse    91 HTDMADITRTYLSSHSSCFWVAESRGQTVGMVAARPVKDPLLQKKQLQLLHLSVSLQHRREGLGK 155

  Fly   175 PMIKLVVKNCIIGGYASLECTISEWQESERDFYDDFGF----VTRQIYHKKIIGSSLAVMKTQLT 235
            .|::.|::...:.|::.:..:.|..|.:....|...||    .|...|..::..|.:..:|..||
Mouse   156 AMVRTVLQFAQMQGFSEVVLSTSMLQYAALALYQGMGFQKTGETFYTYLSRLRKSPMINLKYSLT 220

  Fly   236  235
            Mouse   221  220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32939NP_788618.1 None
Nat8f6NP_001188318.1 RimI <99..198 CDD:223532 16/98 (16%)
Acetyltransf_1 116..194 CDD:278980 12/77 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.