DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32939 and nat8b.2

DIOPT Version :9

Sequence 1:NP_788618.1 Gene:CG32939 / 318260 FlyBaseID:FBgn0052939 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_002936328.3 Gene:nat8b.2 / 100489847 XenbaseID:XB-GENE-6044534 Length:220 Species:Xenopus tropicalis


Alignment Length:228 Identity:38/228 - (16%)
Similarity:80/228 - (35%) Gaps:48/228 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IRNYTQDDELKCQELVRDYIMSFSNKSFFVYCFREITLQFIVITWAIFF--IFLGVPLLFCALTV 69
            ||.|.:.|......|..:..|    :.|...|...:....:.:|..:.|  :.||......:.| 
 Frog     6 IRKYRKKDYAAVCHLFAEGTM----EHFPAACLYVLKAPRVYVTLLLLFASMLLGTKSYILSFT- 65

  Fly    70 PACIFCLFTGTYFSFYSKAVELMRTKPSQSLVAECYEPFIFRCSPK-----EASYQIFTENCPYE 129
              |:..:..|.::...||                 |..::.:...:     |.:|.:.:.:|   
 Frog    66 --CLAAILAGGWWVINSK-----------------YHHYVIQIQREDLQDIEKTYMVRSNSC--- 108

  Fly   130 ETYTRKFRRRIVAAISVKNHHAVYNAAWIYRFAIDPHYPCQTIMDPMIKLVV---KNCIIGGYAS 191
             .:..:...::|..::.:......:...:.|..:...:..:.|...:...|:   |.|   ||.:
 Frog   109 -FWVAESDGKVVGMVAAQPSEESEDEMVLKRLCVGRDHRRKGIAKALCLKVIGFAKEC---GYKA 169

  Fly   192 --LECTISEWQESERDFYDDFGFVTRQIYHKKI 222
              ||..|.::  |.:..|...||   :.||.::
 Frog   170 VCLETDIIQY--SAQKLYQRIGF---EKYHLEV 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32939NP_788618.1 None
nat8b.2XP_002936328.3 Acetyltransf_1 <104..190 CDD:395465 14/94 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.