DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32939 and nat8.3

DIOPT Version :9

Sequence 1:NP_788618.1 Gene:CG32939 / 318260 FlyBaseID:FBgn0052939 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_031751136.1 Gene:nat8.3 / 100489358 XenbaseID:XB-GENE-988088 Length:223 Species:Xenopus tropicalis


Alignment Length:236 Identity:45/236 - (19%)
Similarity:78/236 - (33%) Gaps:75/236 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VIRNYTQDD-----ELKCQELVRDYIMSFSNKSFFVYCFREITLQFIVITWAIFFIFLGVPLLFC 65
            :||.|...|     :|....::.:..::|.....|......:.:.|::...|...|.|...::.|
 Frog     4 IIRIYKDSDYESVIDLYVSGVMENAPVAFKQLLGFPSTQLLLAVGFLLSLAATGSILLPTCIVLC 68

  Fly    66 ALTVP--AC--IFCLFT-------------------GTYFSFYSKAVELMRTKPSQSLVAECYEP 107
            ||...  .|  .||.:.                   |..|.....|.|::      .:||..  |
 Frog    69 ALAFLWWCCRDFFCFYVTNALVTDMRDIRKHYIEMDGHCFWVAESAGEVV------GMVAAL--P 125

  Fly   108 FIFRCSPKEASYQIFTENCPYEETYTRKFRRRIVAAISVKNHHAVYNAAWIYRFAIDPHYPCQTI 172
            |:.                |..|.|. :.:|..||    |:|..:..|..:.|.:||  :.|:..
 Frog   126 FLH----------------PGGEKYV-ELKRMSVA----KSHRGMGIAKDLCRTSID--FACKRG 167

  Fly   173 MDPMIKLVVKNCIIGGYASLECTISEWQESERDFYDDFGFV 213
            .|.:: |......:||:               :.|:..||:
 Frog   168 CDGVV-LTTSTGQVGGW---------------NLYEKTGFI 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32939NP_788618.1 None
nat8.3XP_031751136.1 Acetyltransf_1 74..191 CDD:395465 29/163 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.