DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32939 and nat8.7

DIOPT Version :9

Sequence 1:NP_788618.1 Gene:CG32939 / 318260 FlyBaseID:FBgn0052939 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_012811282.2 Gene:nat8.7 / 100145252 XenbaseID:XB-GENE-5780700 Length:286 Species:Xenopus tropicalis


Alignment Length:167 Identity:32/167 - (19%)
Similarity:62/167 - (37%) Gaps:13/167 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 AIFFIFLGVPLLFCALTVPACIFCLFTGTY-FSFYSKAVELMRTKPSQSLVAECYEPFIFRCSPK 115
            |..|..|.:|.:...|.:|.....|.:.:| |||.|.|: ||.|  ....:...:..::.:|...
 Frog    99 ATSFYLLKLPQIQVLLFIPFITLYLLSKSYTFSFGSLAL-LMAT--GWYGMKSIFSQYVNKCHRA 160

  Fly   116 -----EASYQIFTENCPYEETYTRKFRRRIVAAISVKNHHAVYNAAWIYRFAIDPHYPCQTIMDP 175
                 |.||.:...:|    .:..:...|::..:.::......:|..:.|.::......:.|...
 Frog   161 DLLDIEKSYMMANNSC----FWVAESEGRVIGMVGIQPTQDSKDAMVLRRLSVASEQRVRGIGKA 221

  Fly   176 MIKLVVKNCIIGGYASLECTISEWQESERDFYDDFGF 212
            :....:......||..:....|..|.:....|:..||
 Frog   222 LCMKAIDFARQRGYRRVNLDTSMIQRAAHRLYEGMGF 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32939NP_788618.1 None
nat8.7XP_012811282.2 Acetyltransf_1 143..258 CDD:395465 14/118 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.