DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32939 and nat8l2

DIOPT Version :9

Sequence 1:NP_788618.1 Gene:CG32939 / 318260 FlyBaseID:FBgn0052939 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001373330.1 Gene:nat8l2 / 100004652 ZFINID:ZDB-GENE-131127-633 Length:229 Species:Danio rerio


Alignment Length:233 Identity:45/233 - (19%)
Similarity:77/233 - (33%) Gaps:54/233 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVIRNYTQDDELKCQELVRDYIMSFSNKSFFVYCFREITLQFIVITWAIFFIFLGVPLLFCALTV 69
            ||||:|...|....:.:.|:.|....|.:|.....|.:   .|.|:   .||::...:|      
Zfish     8 IVIRHYQPSDREAVETVFREAIEEHINPAFMYAMTRPL---HITIS---LFIYVSAYIL------ 60

  Fly    70 PACIFCLFTGTYFSFYSKAVELMRTKPSQSLVAECYEPFI-------FRCSPKEAS--YQIFTEN 125
                         |.||..:.||.......||..|...|.       .....|:.|  |....:|
Zfish    61 -------------STYSLVLSLMCGGSWIGLVYFCCHEFYAGYVRSRLNTDMKDISAYYLENPDN 112

  Fly   126 CPYEETYTRKFRRRIVAAISVKNHHAVYNAAWIYRFAIDPHYPC----------QTIMDPMIKLV 180
            |.:......:.|.:::..::|:..........:||..:..  .|          ||..|      
Zfish   113 CFWVAEAEIEGRPQVLGMVAVEGKKGSEKYGELYRMIVSS--ACRRTGLGVKLAQTAED------ 169

  Fly   181 VKNCIIGGYASLECTISEWQESERDFYDDFGFVTRQIY 218
              .|...|::.:..:.|..|::....|...||...:::
Zfish   170 --FCRERGFSKIMLSTSSTQKAAVALYFKLGFKLLRVH 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32939NP_788618.1 None
nat8l2NP_001373330.1 Acetyltransf_1 84..199 CDD:395465 19/124 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.