DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32939 and nat8

DIOPT Version :9

Sequence 1:NP_788618.1 Gene:CG32939 / 318260 FlyBaseID:FBgn0052939 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_001342614.1 Gene:nat8 / 100002956 ZFINID:ZDB-GENE-141216-110 Length:221 Species:Danio rerio


Alignment Length:226 Identity:42/226 - (18%)
Similarity:79/226 - (34%) Gaps:47/226 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVIRNYTQDDELKCQEL----VRDYIMSFSNKSFFVYCFREITLQFIVITWAIFFIFLGVPLLFC 65
            :.||.|.::|..:.:|:    :.::|.|        .|..       |:...:..:|||      
Zfish     4 VQIRQYREEDLEEVKEVFTIGMSEHIPS--------SCMH-------VLKQPLAQMFLG------ 47

  Fly    66 ALTVPACIFCLFTGTYFSFYSK--AVELMRTKPSQSLVAECY--EPFIFRCSPKEASY--QIFTE 124
                  |:||....:..|....  ||.|:.....||:   ||  ..:|.....::.|:  |.:.:
Zfish    48 ------CVFCALLTSSMSILLPVLAVTLLLAAGRQSV---CYMFNKYIQTSLEQDLSHIQQTYMD 103

  Fly   125 NCPYEETYTRKFRRRIVAAISVKNHHAVYNAAWIYRFAIDPHYPCQTIMDPMIKLVVKNCIIGGY 189
            . |....:..:.:.|:|..:.........|...:.|.::...:..:.|...:.:.|.......||
Zfish   104 P-PNACVWVAESQGRVVGTVGCFPSENDKNFLELKRMSVKKAHRGKGIAKALCRTVADFARERGY 167

  Fly   190 ASLECTISEWQESERDFYDDFGFVTRQIYHK 220
            ..:....|..|...:..|:..|      |||
Zfish   168 LGVILHTSVVQTDAQKLYEHMG------YHK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32939NP_788618.1 None
nat8XP_001342614.1 Acetyltransf_1 76..190 CDD:306954 20/123 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.