DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgA and AT5G12320

DIOPT Version :9

Sequence 1:NP_001259366.1 Gene:rdgA / 31826 FlyBaseID:FBgn0261549 Length:1462 Species:Drosophila melanogaster
Sequence 2:NP_568265.2 Gene:AT5G12320 / 831107 AraportID:AT5G12320 Length:144 Species:Arabidopsis thaliana


Alignment Length:116 Identity:41/116 - (35%)
Similarity:55/116 - (47%) Gaps:3/116 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly  1328 DAILLAAQSGDLNMLRALHEQGYSLQSVNKNGQTALHFACKYNHRDIVKYIIASATRRLINMADK 1392
            |.:|.||:..|::.||.|...|.||.|.:..|:||||.|....|..||:|:|:....  ||..:.
plant    13 DDLLEAARYNDIDDLRTLASDGLSLHSRDSQGRTALHMAAANGHMTIVEYLISEGVD--INALND 75

  Fly  1393 ELGQTALHIAAEQNRRDICVMLVAAGAHLDTLDSGGNTPMMVAFNKNANEI 1443
            | ....||.|......::...|:.|||.|..|:....|||..|......||
plant    76 E-NNAPLHWACLNGHVEVVKRLILAGASLSLLNRYERTPMDEAIGAEKMEI 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgANP_001259366.1 C1_1 591..640 CDD:278556
C1_1 661..725 CDD:278556
LCB5 813..1140 CDD:224513
DAGKc 814..942 CDD:214487
DAGKa 969..1123 CDD:214486
ANK 1329..1447 CDD:238125 40/115 (35%)
ANK repeat 1329..1356 CDD:293786 11/26 (42%)
Ank_2 1330..1425 CDD:289560 33/94 (35%)
ANK repeat 1358..1391 CDD:293786 13/32 (41%)
ANK repeat 1393..1425 CDD:293786 9/31 (29%)
Ank_2 1399..>1459 CDD:289560 15/45 (33%)
AT5G12320NP_568265.2 Ank_2 15..107 CDD:403870 33/94 (35%)
ANK repeat 15..41 CDD:293786 11/25 (44%)
ANK repeat 43..74 CDD:293786 13/32 (41%)
ANK repeat 76..107 CDD:293786 9/31 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.