DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgA and DGK7

DIOPT Version :9

Sequence 1:NP_001259366.1 Gene:rdgA / 31826 FlyBaseID:FBgn0261549 Length:1462 Species:Drosophila melanogaster
Sequence 2:NP_567845.4 Gene:DGK7 / 829157 AraportID:AT4G30340 Length:492 Species:Arabidopsis thaliana


Alignment Length:394 Identity:113/394 - (28%)
Similarity:163/394 - (41%) Gaps:107/394 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   812 PVIVFINPKSGGNQGHKLLGKFQHLLNPRQVFDLTQGGP----KMGL-----------DMFRKA- 860
            |::|||||||||..|..|..:.|.|:...||||||:..|    :.||           :..|:. 
plant    94 PMVVFINPKSGGRHGPVLKERLQQLMTEEQVFDLTEVKPHEFVRYGLGCLDTLAAKGDECARECR 158

  Fly   861 PNLRVLACGGDGTVGWVLSVLDQI-QPPLQPAPAVGVLPLGTGNDLARALGWGGSIFFQGYTDEP 924
            ..:|::..||||||||||..|.:: :......|.|||:||||||||:|:..||||..|...:  .
plant   159 EKIRIMVAGGDGTVGWVLGCLGELHKDGKSHIPPVGVIPLGTGNDLSRSFSWGGSFPFAWRS--A 221

  Fly   925 IGKILREIGMSQCVLMDRWRVKVT-PNDDVTD--------------DHVDRSKPNVP------LN 968
            :.:.|....:.....:|.|::.|: |:.:|.|              |....:..:||      ..
plant   222 MKRTLHRATLGSIARLDSWKIVVSMPSGEVVDPPYSLKPTIEETALDQALDADGDVPPKAKSYEG 286

  Fly   969 VINNYFSFGVDAHIALEFHEAREAHPERFNSRLRNKMYYGQMGGKDLILRQYRNLSQWVTLECDG 1033
            |..||||.|:||.:|..||..|...|......:.||:.|.          .|.....|....|..
plant   287 VFYNYFSIGMDAQVAYGFHHLRNEKPYLAQGPVTNKIIYS----------SYSCTQGWFCTPCVN 341

  Fly  1034 QDFTGKLRD--------AGC------------HAVLFLNIPSYGGGTHPWN-------DSFGASK 1071
            ......||:        |.|            .:::.||:.:||.|.|||.       :..|..:
plant   342 NPALRGLRNIMKIHIKKANCSEWEEIHVPKSVRSIVVLNLYNYGSGRHPWGNLRPKYLEKRGFVE 406

  Fly  1072 PSIDDGLMEVVGLTTYQLPMLQAGMHGTCICQCRKARIITKRTIP------------------MQ 1118
            ...||||:|:.|        |:.|.|.:.:    .|.||:.:.|.                  :|
plant   407 AHCDDGLIEIFG--------LKQGWHASFV----MAEIISAKHIAQAAAIRFELRGGDWKNAFLQ 459

  Fly  1119 VDGE 1122
            :|||
plant   460 MDGE 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgANP_001259366.1 C1_1 591..640 CDD:278556
C1_1 661..725 CDD:278556
LCB5 813..1140 CDD:224513 112/393 (28%)
DAGKc 814..942 CDD:214487 54/144 (38%)
DAGKa 969..1123 CDD:214486 49/199 (25%)
ANK 1329..1447 CDD:238125
ANK repeat 1329..1356 CDD:293786
Ank_2 1330..1425 CDD:289560
ANK repeat 1358..1391 CDD:293786
ANK repeat 1393..1425 CDD:293786
Ank_2 1399..>1459 CDD:289560
DGK7NP_567845.4 DAGK_cat 94..234 CDD:395631 55/141 (39%)
DAGK_acc 287..464 CDD:395484 49/199 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.