DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgA and DGK6

DIOPT Version :9

Sequence 1:NP_001259366.1 Gene:rdgA / 31826 FlyBaseID:FBgn0261549 Length:1462 Species:Drosophila melanogaster
Sequence 2:NP_194542.2 Gene:DGK6 / 828928 AraportID:AT4G28130 Length:466 Species:Arabidopsis thaliana


Alignment Length:430 Identity:122/430 - (28%)
Similarity:198/430 - (46%) Gaps:93/430 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   799 AFIVKPIPSPEV---------IPVIVFINPKSGGNQGHKLLGKFQHLLNPRQVFDLTQGGP---- 850
            ::::.|...||.         .|::||||.||||..|.:|:..::.|||.:|||||....|    
plant    25 SYVLSPEDEPEAQISCTTAPENPILVFINSKSGGQLGAELILTYRTLLNDKQVFDLEVETPDKVL 89

  Fly   851 -KMGLDMFRKAPN---------LRVLACGGDGTVGWVLSVLDQIQPPLQPAPAVGVLPLGTGNDL 905
             ::.|::.|...:         |:::..|||||.||:|.|:..:.  |...|.:..:||||||:|
plant    90 QRIYLNLERLKDDSLASKIRDKLKIIVAGGDGTAGWLLGVVSDLN--LSNPPPIATVPLGTGNNL 152

  Fly   906 ARALGWGGSIFFQGYTDEP-----IGKILREIGMSQCVLMDRWRVKVT---PND---DVTDDHVD 959
            ..|.|||..   ...||..     :||::....|.    :|.|::.:.   |.:   |:| ..:.
plant   153 PFAFGWGKK---NPGTDRSSVESFLGKVINAKEMK----IDNWKILMRMKHPKEGSCDIT-LKLP 209

  Fly   960 RSKPNV-PLNVIN------------NYFSFGVDAHIALEFHEAREAHPERFNSRLRNKMYYGQMG 1011
            .|.|.: |.:..|            ||||.|:||.::..||..|:.|||||.::|.|:..|.::.
plant   210 HSLPRIFPSDQENMEGYHTYRGGFWNYFSLGMDAQVSYAFHSQRKLHPERFKNQLVNQSTYLKLS 274

  Fly  1012 ------GKDLILRQYRNLSQWVTLE-CDGQDFTGKLRD----AGCHAVLFLNIPSYGGGTHPWND 1065
                  ...|.....:|:::...:: ||.   .|:..|    ....:::.||:||:.||.:||..
plant   275 CTQGWFFASLFHPSSQNIAKLAKIQICDR---NGQWNDLHIPQSIRSIVCLNLPSFSGGLNPWGT 336

  Fly  1066 -------SFGASKPSIDDGLMEVVGLTT--YQLPMLQAGMHGTCICQCRKARIITKRTIP----M 1117
                   ....:.|.:||||:|:||...  :.|.:|....|||.:.|..:.|:..|:...    |
plant   337 PNPKKQRDRSLTAPFVDDGLIEIVGFRNAWHGLILLSPNGHGTRLAQANRVRLEFKKGAAKHAYM 401

  Fly  1118 QVDGEACRVKPSVIEIELLNKALMLSKRKHGRGDVQVNPL 1157
            ::|||     |....:...::.:|:....||    |||.|
plant   402 RIDGE-----PWKQPLPSNDETVMVEISHHG----QVNML 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgANP_001259366.1 C1_1 591..640 CDD:278556
C1_1 661..725 CDD:278556
LCB5 813..1140 CDD:224513 111/388 (29%)
DAGKc 814..942 CDD:214487 49/146 (34%)
DAGKa 969..1123 CDD:214486 52/189 (28%)
ANK 1329..1447 CDD:238125
ANK repeat 1329..1356 CDD:293786
Ank_2 1330..1425 CDD:289560
ANK repeat 1358..1391 CDD:293786
ANK repeat 1393..1425 CDD:293786
Ank_2 1399..>1459 CDD:289560
DGK6NP_194542.2 DAGK_cat 47..160 CDD:279163 44/114 (39%)
DAGK_acc 235..407 CDD:295305 52/179 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.