DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32857 and NFU5

DIOPT Version :9

Sequence 1:NP_728443.1 Gene:CG32857 / 318252 FlyBaseID:FBgn0052857 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_175550.2 Gene:NFU5 / 841563 AraportID:AT1G51390 Length:275 Species:Arabidopsis thaliana


Alignment Length:193 Identity:113/193 - (58%)
Similarity:148/193 - (76%) Gaps:5/193 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RRSMFIQTQDTPNPESLKFLPGVDVLGKGNTYDFPNGTTAHNSPLAKLLFRVEGVKGVFFGADFV 128
            ||:||||||.||||.||.|.||..|:..|:. ||||..:|.:|||||.:|.::||..||:|:|||
plant    72 RRTMFIQTQSTPNPSSLMFSPGKPVMEIGSA-DFPNSRSAMSSPLAKAIFAIDGVVRVFYGSDFV 135

  Fly   129 TISKQEGAEWSLIKPEVFAVIMDFFASGLPVLNDAQPNA--DTEILEDDDETVMMIKELLDTRIR 191
            |::|.:...|.::||::|||:|||::||.|:..|:|..|  ||.|.|||.|||.||||||:||||
plant   136 TVTKSDDVTWDILKPDIFAVVMDFYSSGQPLFLDSQATAAKDTAIHEDDSETVAMIKELLETRIR 200

  Fly   192 PTVQEDGGDIVFMGY--EGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESVEQVFD 252
            |:||:|||||.:.|:  |.|:|||:|||:||.||||.||||:|::|||..|:.||:.|||.||
plant   201 PSVQDDGGDIEYCGFDTETGIVKLRMQGACSGCPSSSVTLKSGIENMLMHYVSEVKGVEQEFD 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32857NP_728443.1 Nfu_N 69..149 CDD:285874 41/79 (52%)
NifU 182..248 CDD:279451 43/67 (64%)
NFU5NP_175550.2 Nfu_N 77..163 CDD:214919 45/86 (52%)
NifU 182..267 CDD:223766 55/82 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 105 1.000 Domainoid score I2212
eggNOG 1 0.900 - - E1_COG0694
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6369
Inparanoid 1 1.050 230 1.000 Inparanoid score I1144
OMA 1 1.010 - - QHG63177
OrthoDB 1 1.010 - - D1016782at2759
OrthoFinder 1 1.000 - - FOG0002982
OrthoInspector 1 1.000 - - otm2508
orthoMCL 1 0.900 - - OOG6_101229
Panther 1 1.100 - - O PTHR11178
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2337
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.