DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32857 and nfu1

DIOPT Version :9

Sequence 1:NP_728443.1 Gene:CG32857 / 318252 FlyBaseID:FBgn0052857 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_012822187.1 Gene:nfu1 / 779809 XenbaseID:XB-GENE-1002900 Length:252 Species:Xenopus tropicalis


Alignment Length:195 Identity:125/195 - (64%)
Similarity:155/195 - (79%) Gaps:5/195 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PVACRRSMFIQTQDTPNPESLKFLPGVDVLGKGNTYDFPNGTTAHNSPLAKLLFRVEGVKGVFFG 124
            ||.|   |||||||||||.|:||:||..|| ...|.|||:..:|..||||:.|||::|||.||.|
 Frog    50 PVRC---MFIQTQDTPNPNSVKFIPGRAVL-DARTMDFPSPASAFCSPLARHLFRIDGVKSVFLG 110

  Fly   125 ADFVTISK-QEGAEWSLIKPEVFAVIMDFFASGLPVLNDAQPNADTEILEDDDETVMMIKELLDT 188
            .||:||:| .|..:|:||||:::|.|||||||||||:.:..|..|....|::||.|.||||||||
 Frog   111 PDFITITKNSEELDWNLIKPDIYATIMDFFASGLPVVTEDAPRGDAAASEEEDEVVAMIKELLDT 175

  Fly   189 RIRPTVQEDGGDIVFMGYEGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESVEQVFDE 253
            ||||||||||||:::.|::.|:|:||:||||:||||||:|||:|:||||||||||||.||||.||
 Frog   176 RIRPTVQEDGGDVLYKGFQDGIVQLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVEGVEQVTDE 240

  Fly   254  253
             Frog   241  240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32857NP_728443.1 Nfu_N 69..149 CDD:285874 46/80 (58%)
NifU 182..248 CDD:279451 50/65 (77%)
nfu1XP_012822187.1 Nfu_N 56..143 CDD:378032 52/87 (60%)
NifU 169..235 CDD:376458 50/65 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5821
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6369
Inparanoid 1 1.050 255 1.000 Inparanoid score I3105
OMA 1 1.010 - - QHG63177
OrthoDB 1 1.010 - - D1016782at2759
OrthoFinder 1 1.000 - - FOG0002982
OrthoInspector 1 1.000 - - oto105497
Panther 1 1.100 - - LDO PTHR11178
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3877
SonicParanoid 1 1.000 - - X2337
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.