DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS21 and Mrps21

DIOPT Version :10

Sequence 1:NP_731803.1 Gene:mRpS21 / 318249 FlyBaseID:FBgn0044511 Length:87 Species:Drosophila melanogaster
Sequence 2:NP_001119566.1 Gene:Mrps21 / 689432 RGDID:1592330 Length:87 Species:Rattus norvegicus


Alignment Length:85 Identity:45/85 - (52%)
Similarity:65/85 - (76%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RHVQFLARTVLVQNNNVEEACRLLNRVLGKEELLDQFRRTRFYEKPYQVRRRINFEKCKAIYNED 66
            :|::|:||||:||..|||.|.|.|||:|..:.|:|..:|.|:||||.:.|:|.::|.|:.|||.:
  Rat     3 KHLKFIARTVMVQEGNVEGAYRTLNRILTTDGLIDVIKRRRYYEKPCRRRQRESYETCRRIYNME 67

  Fly    67 MNRKIQFVLRKNRAEPFPGC 86
            |.|||.|::|||||:|:.||
  Rat    68 MARKINFLMRKNRADPWLGC 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS21NP_731803.1 S21p 9..65 CDD:129141 28/55 (51%)
Mrps21NP_001119566.1 S21p 10..66 CDD:129141 28/55 (51%)

Return to query results.
Submit another query.