DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS21 and Mrps21

DIOPT Version :9

Sequence 1:NP_001262535.1 Gene:mRpS21 / 318249 FlyBaseID:FBgn0044511 Length:87 Species:Drosophila melanogaster
Sequence 2:NP_001342688.1 Gene:Mrps21 / 66292 MGIID:1913542 Length:87 Species:Mus musculus


Alignment Length:85 Identity:44/85 - (51%)
Similarity:63/85 - (74%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RHVQFLARTVLVQNNNVEEACRLLNRVLGKEELLDQFRRTRFYEKPYQVRRRINFEKCKAIYNED 66
            :|::|:||||:||..|||.|.|.|||:|..:.|.:...|.|:||||.:.|:|.::|.|:.|||.:
Mouse     3 KHLKFIARTVMVQEGNVEGAYRTLNRILTTDGLTEVISRRRYYEKPCRRRQRESYETCRRIYNME 67

  Fly    67 MNRKIQFVLRKNRAEPFPGC 86
            |.|||.|::|||||:|:.||
Mouse    68 MARKINFLMRKNRADPWLGC 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS21NP_001262535.1 S21p 9..65 CDD:129141 27/55 (49%)
Mrps21NP_001342688.1 S21p 10..66 CDD:129141 27/55 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I11470
eggNOG 1 0.900 - - E1_2CTF9
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H45365
Inparanoid 1 1.050 95 1.000 Inparanoid score I5043
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49145
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006362
OrthoInspector 1 1.000 - - oto93673
orthoMCL 1 0.900 - - OOG6_106076
Panther 1 1.100 - - LDO PTHR21109
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8866
SonicParanoid 1 1.000 - - X4631
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.860

Return to query results.
Submit another query.