DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS21 and mrps21

DIOPT Version :9

Sequence 1:NP_001262535.1 Gene:mRpS21 / 318249 FlyBaseID:FBgn0044511 Length:87 Species:Drosophila melanogaster
Sequence 2:NP_001016340.1 Gene:mrps21 / 549094 XenbaseID:XB-GENE-1010108 Length:87 Species:Xenopus tropicalis


Alignment Length:84 Identity:42/84 - (50%)
Similarity:64/84 - (76%) Gaps:0/84 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HVQFLARTVLVQNNNVEEACRLLNRVLGKEELLDQFRRTRFYEKPYQVRRRINFEKCKAIYNEDM 67
            |::|:||||:|.:.||:.|.::|||:|..:.::|:.||.|:||||...|||.|:|.|:.|||.:|
 Frog     4 HLKFIARTVMVPSGNVDMAYKMLNRILTVDGIVDEARRRRYYEKPCNKRRRENYENCRRIYNSEM 68

  Fly    68 NRKIQFVLRKNRAEPFPGC 86
            ..|:.|::||||.:|:|||
 Frog    69 AGKVSFLMRKNRQDPWPGC 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS21NP_001262535.1 S21p 9..65 CDD:129141 27/55 (49%)
mrps21NP_001016340.1 S21p 10..65 CDD:129141 26/54 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10760
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H45365
Inparanoid 1 1.050 100 1.000 Inparanoid score I4865
OMA 1 1.010 - - QHG49145
OrthoDB 1 1.010 - - D1512634at2759
OrthoFinder 1 1.000 - - FOG0006362
OrthoInspector 1 1.000 - - oto103905
Panther 1 1.100 - - LDO PTHR21109
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8866
SonicParanoid 1 1.000 - - X4631
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.