DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS21 and MRPS21

DIOPT Version :9

Sequence 1:NP_001262535.1 Gene:mRpS21 / 318249 FlyBaseID:FBgn0044511 Length:87 Species:Drosophila melanogaster
Sequence 2:NP_061870.1 Gene:MRPS21 / 54460 HGNCID:14046 Length:87 Species:Homo sapiens


Alignment Length:85 Identity:43/85 - (50%)
Similarity:65/85 - (76%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RHVQFLARTVLVQNNNVEEACRLLNRVLGKEELLDQFRRTRFYEKPYQVRRRINFEKCKAIYNED 66
            :|::|:||||:||..|||.|.|.|||:|..:.|::..:..|:||||.:.|:|.::|:|:.|||.:
Human     3 KHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCRRRQRESYERCRRIYNME 67

  Fly    67 MNRKIQFVLRKNRAEPFPGC 86
            |.|||.|::|||||:|:.||
Human    68 MARKINFLMRKNRADPWQGC 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS21NP_001262535.1 S21p 9..65 CDD:129141 26/55 (47%)
MRPS21NP_061870.1 S21p 10..66 CDD:129141 26/55 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11406
eggNOG 1 0.900 - - E1_2CTF9
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H45365
Inparanoid 1 1.050 98 1.000 Inparanoid score I5037
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49145
OrthoDB 1 1.010 - - D1512634at2759
OrthoFinder 1 1.000 - - FOG0006362
OrthoInspector 1 1.000 - - oto90098
orthoMCL 1 0.900 - - OOG6_106076
Panther 1 1.100 - - LDO PTHR21109
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8866
SonicParanoid 1 1.000 - - X4631
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.