DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS21 and Mrps21l

DIOPT Version :9

Sequence 1:NP_001262535.1 Gene:mRpS21 / 318249 FlyBaseID:FBgn0044511 Length:87 Species:Drosophila melanogaster
Sequence 2:XP_344707.1 Gene:Mrps21l / 364906 RGDID:1307398 Length:100 Species:Rattus norvegicus


Alignment Length:98 Identity:47/98 - (47%)
Similarity:66/98 - (67%) Gaps:13/98 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RHVQFLARTVLVQNNNVEEACRLLNRVLGKEELLDQFRRTRFYEKPYQVRRRINFEK-------- 58
            :|::|:||||:||..|||.|.|.|||:|..:.|:|..:|.|:|||||.::||..:||        
  Rat     3 KHLKFIARTVMVQEGNVEGAYRTLNRILTTDGLIDVIKRRRYYEKPYVIKRRRYYEKPCRRRRQR 67

  Fly    59 -----CKAIYNEDMNRKIQFVLRKNRAEPFPGC 86
                 |:.|||.:|.|||.|::|||||:|:.||
  Rat    68 ESYETCQRIYNMEMARKINFLMRKNRADPWLGC 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS21NP_001262535.1 S21p 9..65 CDD:129141 30/68 (44%)
Mrps21lXP_344707.1 S21p 10..65 CDD:129141 27/54 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10732
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I4897
OMA 1 1.010 - - QHG49145
OrthoDB 1 1.010 - - D1512634at2759
OrthoFinder 1 1.000 - - FOG0006362
OrthoInspector 1 1.000 - - otm45512
orthoMCL 1 0.900 - - OOG6_106076
Panther 1 1.100 - - O PTHR21109
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4631
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.