DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf11 and RMR1

DIOPT Version :10

Sequence 1:NP_726563.1 Gene:Rnf11 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_201417.1 Gene:RMR1 / 836748 AraportID:AT5G66160 Length:310 Species:Arabidopsis thaliana


Alignment Length:74 Identity:28/74 - (37%)
Similarity:43/74 - (58%) Gaps:3/74 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LMQYLPIGTY-DGSSKKARE-CVICMAEFCVNEAVRYLPCMHIYHVNCIDDWLLR-SLTCPSCLE 134
            |:..||..|: |.:..||.| |.||:.::...|::|.|||.|.:|:||||.||.: ..:||.|..
plant   211 LVHTLPCFTFTDSAHHKAGETCAICLEDYRFGESLRLLPCQHAFHLNCIDSWLTKWGTSCPVCKH 275

  Fly   135 PVDAALLTS 143
            .:....::|
plant   276 DIRTETMSS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf11NP_726563.1 RING-H2_RNF11 91..133 CDD:438131 19/43 (44%)
RMR1NP_201417.1 PA_C_RZF_like 28..166 CDD:239038
RING_Ubox 230..277 CDD:473075 20/46 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.