DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf11 and AT5G07040

DIOPT Version :10

Sequence 1:NP_726563.1 Gene:Rnf11 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_196321.1 Gene:AT5G07040 / 830595 AraportID:AT5G07040 Length:159 Species:Arabidopsis thaliana


Alignment Length:53 Identity:22/53 - (41%)
Similarity:31/53 - (58%) Gaps:2/53 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CVICMAEFCVNEAVRYLP-CMHIYHVNCIDDWLLRSLTCPSCL-EPVDAALLT 142
            |.||:.::...|.||.:| |.|.:|.:|:|:||..|.|||.|. .|..:.|.|
plant    94 CSICLCDYEAREPVRCIPECNHCFHTDCVDEWLRTSATCPLCRNSPAPSRLAT 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf11NP_726563.1 RING-H2_RNF11 91..133 CDD:438131 18/41 (44%)
AT5G07040NP_196321.1 RING-H2_EL5-like 94..136 CDD:438124 18/41 (44%)

Return to query results.
Submit another query.