DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf11 and RHA3B

DIOPT Version :10

Sequence 1:NP_726563.1 Gene:Rnf11 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_195273.1 Gene:RHA3B / 829700 AraportID:AT4G35480 Length:200 Species:Arabidopsis thaliana


Alignment Length:95 Identity:35/95 - (36%)
Similarity:42/95 - (44%) Gaps:21/95 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 MQYLPIGTYDGSSKKA-----------------RECVICMAEFCVNEAVRYLP-CMHIYHVNCID 120
            :|.||..||..|:..|                 .||.||:.||...|.:|.|| |.|.:||.|||
plant    78 LQALPKSTYTASASTAAAADDLPCSSVGDGDSSTECAICITEFSEGEEIRILPLCSHAFHVACID 142

  Fly   121 DWLLRSLTCPSC---LEPVDAALLTSYEST 147
            .||....:||||   |.||.......:.||
plant   143 KWLTSRSSCPSCRRILVPVKCDRCGHHAST 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf11NP_726563.1 RING-H2_RNF11 91..133 CDD:438131 23/45 (51%)
RHA3BNP_195273.1 RING-H2_EL5-like 112..155 CDD:438124 22/42 (52%)

Return to query results.
Submit another query.