DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf11 and AT3G61550

DIOPT Version :10

Sequence 1:NP_726563.1 Gene:Rnf11 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_191714.1 Gene:AT3G61550 / 825328 AraportID:AT3G61550 Length:212 Species:Arabidopsis thaliana


Alignment Length:54 Identity:21/54 - (38%)
Similarity:32/54 - (59%) Gaps:2/54 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 GTYDGSSKKARECVICMAEFCVNEAVRYLP-CMHIYHVNCIDDWLLRSLTCPSC 132
            |.:||..::. .|.||:.|:...|.:|.:| |.|.:||.|:|.||..:.:||.|
plant   125 GFHDGEGRET-TCSICLCEYMEEEMLRMMPECKHYFHVYCLDAWLKLNGSCPVC 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf11NP_726563.1 RING-H2_RNF11 91..133 CDD:438131 18/43 (42%)
AT3G61550NP_191714.1 RING_Ubox 136..178 CDD:473075 18/42 (43%)

Return to query results.
Submit another query.