DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32850 and rnf111

DIOPT Version :9

Sequence 1:	NP_726563.1	Gene:	CG32850 / 318246	FlyBaseID:	FBgn0052850	Length:	147	Species:	Drosophila melanogaster
Sequence 2:	NP_001072805.1	Gene:	rnf111 / 780266	XenbaseID:	XB-GENE-854131	Length:	954	Species:	Xenopus tropicalis

Alignment Length:	52	Identity:	22/52 - (42%)
Similarity:	31/52 - (59%)	Gaps:	0/52 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    91 ECVICMAEFCVNEAVRYLPCMHIYHVNCIDDWLLRSLTCPSCLEPVDAALLT 142
            :|.||::.....|.||.|||||::|..|:|.||:.:..||.|...:|..|.|
Frog   901 KCTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDIDTQLPT 952

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32850	NP_726563.1	zf-RING_2	91..132	CDD:290367	18/40 (45%)
rnf111	NP_001072805.1	RNF111_N	1..272	CDD:405891
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	50..175
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	193..276
		SUMO interaction motif 1 (SIM). /evidence=ECO:0000250\|UniProtKB:Q6ZNA4	280..284
		SUMO interaction motif 2 (SIM). /evidence=ECO:0000250\|UniProtKB:Q6ZNA4	305..311
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	318..346
		SUMO interaction motif 3 (SIM). /evidence=ECO:0000250\|UniProtKB:Q6ZNA4	360..364
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	364..452
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	485..509
		Ubiquitin binding. /evidence=ECO:0000250\|UniProtKB:Q6ZSG1	867..869
		RING-H2_RNF111_like	901..945	CDD:319388	19/43 (44%)
		Ubiquitin binding. /evidence=ECO:0000250\|UniProtKB:Q6ZSG1	917..921		2/3 (67%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910