DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf11 and Rnf181

DIOPT Version :10

Sequence 1:NP_726563.1 Gene:Rnf11 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001318100.1 Gene:Rnf181 / 66510 MGIID:1913760 Length:206 Species:Mus musculus


Alignment Length:102 Identity:26/102 - (25%)
Similarity:43/102 - (42%) Gaps:36/102 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LMQYLPIGTYDGSSKKARECVICMAEFCVNEAVRYLPCMHIYHVNCIDDWLLR------------ 125
            :::.|| .|...|:|...:|.:|:.||...|.|..:||.|::|.|||..||.|            
Mouse    70 VVESLP-RTVISSAKADLKCPVCLLEFEAEETVIEMPCHHLFHSNCILPWLRREQGWKAGAGKDR 133

  Fly   126 ---------------SLTCPSCLEPVDAALLTSYEST 147
                           :::||        .::|:.:||
Mouse   134 NTALDFSRQIPALCAAMSCP--------LMMTAMKST 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf11NP_726563.1 RING-H2_RNF11 91..133 CDD:438131 18/68 (26%)
Rnf181NP_001318100.1 COG5540 <52..119 CDD:227827 18/49 (37%)
RING_Ubox 87..>121 CDD:473075 15/33 (45%)

Return to query results.
Submit another query.