DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32850 and rnf38

DIOPT Version :9

Sequence 1:NP_726563.1 Gene:CG32850 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:XP_021331935.1 Gene:rnf38 / 566820 ZFINID:ZDB-GENE-030131-8693 Length:676 Species:Danio rerio


Alignment Length:139 Identity:37/139 - (26%)
Similarity:63/139 - (45%) Gaps:33/139 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SQISGTQPVYHQGEHYQRELYP---STSSSTTLTPSSNNRQLS-----DENQVK-------IAKR 70
            ||.:...|.||.      .|.|   ...|...:.|::....:|     |:.:|:       :|:|
Zfish   532 SQQAVPPPPYHP------SLLPYFLLVRSVLPVQPTAVGPAISLELDVDDGEVENYEALLNLAER 590

  Fly    71 IGL----------MQYLPIGTYDGSSKKARE--CVICMAEFCVNEAVRYLPCMHIYHVNCIDDWL 123
            :|.          ::.||...::.|:.::.:  ||:||.:|...:.:|.|||.|.:|..|:|.||
Zfish   591 LGEAKPRGLTKADIEQLPSYRFNPSNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWL 655

  Fly   124 LRSLTCPSC 132
            ..:.|||.|
Zfish   656 KANRTCPIC 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32850NP_726563.1 zf-RING_2 91..132 CDD:290367 18/42 (43%)
rnf38XP_021331935.1 RING-H2_RNF38_like 621..665 CDD:319386 19/44 (43%)
RING-H2 finger (C3H2C3-type) 624..664 CDD:319386 18/39 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.