powered by:
Protein Alignment CG32850 and rnf115b
DIOPT Version :9
Sequence 1: | NP_726563.1 |
Gene: | CG32850 / 318246 |
FlyBaseID: | FBgn0052850 |
Length: | 147 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_003200594.1 |
Gene: | rnf115b / 563879 |
ZFINID: | ZDB-GENE-060503-608 |
Length: | 301 |
Species: | Danio rerio |
Alignment Length: | 68 |
Identity: | 29/68 - (42%) |
Similarity: | 40/68 - (58%) |
Gaps: | 5/68 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 LMQYLPIGTYDGSSKKAR---ECVICMAEFCVNEAVRYLPCMHIYHVNCIDDWLLRSLTCPSCLE 134
::..|| |...||::|. ||.:|..||.|.|:||.|||:|.:|.:||..||....|||.|.:
Zfish 205 MISSLP--TVSISSEQAACRLECPVCREEFSVGESVRQLPCLHYFHSSCIVPWLQLHDTCPVCRK 267
Fly 135 PVD 137
.:|
Zfish 268 SLD 270
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.