DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32850 and rnf115b

DIOPT Version :9

Sequence 1:NP_726563.1 Gene:CG32850 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:XP_003200594.1 Gene:rnf115b / 563879 ZFINID:ZDB-GENE-060503-608 Length:301 Species:Danio rerio


Alignment Length:68 Identity:29/68 - (42%)
Similarity:40/68 - (58%) Gaps:5/68 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LMQYLPIGTYDGSSKKAR---ECVICMAEFCVNEAVRYLPCMHIYHVNCIDDWLLRSLTCPSCLE 134
            ::..||  |...||::|.   ||.:|..||.|.|:||.|||:|.:|.:||..||....|||.|.:
Zfish   205 MISSLP--TVSISSEQAACRLECPVCREEFSVGESVRQLPCLHYFHSSCIVPWLQLHDTCPVCRK 267

  Fly   135 PVD 137
            .:|
Zfish   268 SLD 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32850NP_726563.1 zf-RING_2 91..132 CDD:290367 21/40 (53%)
rnf115bXP_003200594.1 zinc_ribbon_9 11..41 CDD:291067
zf-RING_2 224..266 CDD:290367 21/41 (51%)
RING <250..288 CDD:302633 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.