DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32850 and si:ch211-59o9.10

DIOPT Version :9

Sequence 1:NP_726563.1 Gene:CG32850 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001352283.1 Gene:si:ch211-59o9.10 / 561841 ZFINID:ZDB-GENE-101206-1 Length:474 Species:Danio rerio


Alignment Length:147 Identity:45/147 - (30%)
Similarity:65/147 - (44%) Gaps:34/147 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TSDDISLLRGNDSQISGTQPVYHQGE---------------HYQRELYPSTSSSTTLTPSSNNRQ 58
            |..::|.|:   ..|.|.||...||.               |.|.:|:..:        ..||.:
Zfish   328 TPSELSELQ---QVIFGEQPHRQQGRRQTGRTRASRRRPAAHLQMDLFNDS--------QGNNYE 381

  Fly    59 ---LSDENQVKIAKRIGL----MQYLPIGTYDGSSKKAR-ECVICMAEFCVNEAVRYLPCMHIYH 115
               ..:|.|..:..:..|    ::.|||.|||.:....: :|.||.:|:...|.:|.|||:|.||
Zfish   382 ALLAFEEQQGAVMAKNTLSKAEIERLPIKTYDPTHSAGKTDCQICFSEYKAGERLRMLPCLHDYH 446

  Fly   116 VNCIDDWLLRSLTCPSC 132
            |.|||.||..:.|||.|
Zfish   447 VKCIDRWLKENATCPIC 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32850NP_726563.1 zf-RING_2 91..132 CDD:290367 21/40 (53%)
si:ch211-59o9.10NP_001352283.1 RING_Ubox 423..464 CDD:327409 22/41 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000414
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.