DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32850 and rnf11

DIOPT Version :9

Sequence 1:NP_726563.1 Gene:CG32850 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001016437.1 Gene:rnf11 / 549191 XenbaseID:XB-GENE-852608 Length:154 Species:Xenopus tropicalis


Alignment Length:169 Identity:87/169 - (51%)
Similarity:104/169 - (61%) Gaps:39/169 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNCLKISTSDDISLLR-----------GNDS--------QISGTQPVYHQGEHYQRELYPSTSS 46
            ||||||..||||||||.           |||.        |.....||||           .|.|
 Frog     1 MGNCLKSPTSDDISLLHESQSDRASYGDGNDGDQEPPPPYQEQAPVPVYH-----------PTPS 54

  Fly    47 STTLTPSSNNRQLSDENQVKIAKRIGLMQYLPIGTY----DGSSKKARECVICMAEFCVNEAVRY 107
            .|.|.     .||::|.|::||:||||:|:||.|.|    |||.||.|||||||.:|...:.:|:
 Frog    55 QTRLA-----TQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRF 114

  Fly   108 LPCMHIYHVNCIDDWLLRSLTCPSCLEPVDAALLTSYES 146
            ||||||||::||||||:||.|||||:||||||||:|||:
 Frog   115 LPCMHIYHMDCIDDWLMRSFTCPSCMEPVDAALLSSYET 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32850NP_726563.1 zf-RING_2 91..132 CDD:290367 27/40 (68%)
rnf11NP_001016437.1 RING-H2_RNF11 98..140 CDD:319382 28/41 (68%)
RING-H2 finger (C3H2C3-type) 99..139 CDD:319382 26/39 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I8557
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H32195
Inparanoid 1 1.050 160 1.000 Inparanoid score I4142
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1261762at2759
OrthoFinder 1 1.000 - - FOG0000414
OrthoInspector 1 1.000 - - otm47811
Panther 1 1.100 - - LDO PTHR46359
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3666
SonicParanoid 1 1.000 - - X150
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.