powered by:
Protein Alignment CG32850 and rlim
DIOPT Version :9
Sequence 1: | NP_726563.1 |
Gene: | CG32850 / 318246 |
FlyBaseID: | FBgn0052850 |
Length: | 147 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001016091.1 |
Gene: | rlim / 548845 |
XenbaseID: | XB-GENE-492020 |
Length: | 639 |
Species: | Xenopus tropicalis |
Alignment Length: | 53 |
Identity: | 22/53 - (41%) |
Similarity: | 30/53 - (56%) |
Gaps: | 0/53 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 GSSKKARECVICMAEFCVNEAVRYLPCMHIYHVNCIDDWLLRSLTCPSCLEPV 136
|.:...:.|.:|:.|:.....:|.|||.|.|||:|||.||..:.|||.|...|
Frog 577 GENDALKTCSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAV 629
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.