DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32850 and rnf11.2

DIOPT Version :9

Sequence 1:NP_726563.1 Gene:CG32850 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001006833.1 Gene:rnf11.2 / 448572 XenbaseID:XB-GENE-5888819 Length:146 Species:Xenopus tropicalis


Alignment Length:154 Identity:82/154 - (53%)
Similarity:103/154 - (66%) Gaps:17/154 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNCLKISTSDDISLLRGND-SQISGTQPVYHQGEHYQRE---LYPSTSSSTTLTPSSNNRQLSD 61
            |||||....:||:|||..:| :.:.|..|..:|    :||   :|..|.|.|.|.     .||::
 Frog     1 MGNCLSSQAADDLSLLNDSDGASLPGEPPPPYQ----EREPVPVYHPTPSQTRLA-----TQLTE 56

  Fly    62 ENQVKIAKRIGLMQYLPIGTYDGSS----KKARECVICMAEFCVNEAVRYLPCMHIYHVNCIDDW 122
            |.||.||:||||:.:||.|.||..|    ||.:||||||.:|...:.||:|||||||||.|||||
 Frog    57 EEQVWIAQRIGLIHHLPKGRYDPGSGPAEKKLKECVICMLDFVGGDPVRFLPCMHIYHVECIDDW 121

  Fly   123 LLRSLTCPSCLEPVDAALLTSYES 146
            |:||.|||||:||||||||:|||:
 Frog   122 LMRSFTCPSCMEPVDAALLSSYET 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32850NP_726563.1 zf-RING_2 91..132 CDD:290367 29/40 (73%)
rnf11.2NP_001006833.1 RING-H2_RNF11 90..132 CDD:319382 30/41 (73%)
RING-H2 finger (C3H2C3-type) 91..131 CDD:319382 28/39 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I8557
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4142
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1261762at2759
OrthoFinder 1 1.000 - - FOG0000414
OrthoInspector 1 1.000 - - otm47811
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3666
SonicParanoid 1 1.000 - - X150
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.