DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32850 and Iru

DIOPT Version :9

Sequence 1:NP_726563.1 Gene:CG32850 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster


Alignment Length:85 Identity:31/85 - (36%)
Similarity:44/85 - (51%) Gaps:3/85 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 TTLTPSSNNRQLSDENQVKIAKRIGLMQYLPIGTYDGSSKKARECVICMAEFCVNEAVRYLPCMH 112
            |.:|...|..:.|....:. |:||..:..:.|...:.:.|  .:|.||..:|.::|.||.|||.|
  Fly   212 TIVTQMLNQMETSGPPPLS-AQRINEIPNVQINAEEVNRK--IQCSICWDDFKIDETVRKLPCSH 273

  Fly   113 IYHVNCIDDWLLRSLTCPSC 132
            :||.|||..||....|||.|
  Fly   274 LYHENCIVPWLNLHSTCPIC 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32850NP_726563.1 zf-RING_2 91..132 CDD:290367 21/40 (53%)
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030
RING-H2_RNF126_like 252..294 CDD:319581 22/42 (52%)
HRD1 <253..372 CDD:227568 22/41 (54%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 21/39 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.