DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf11 and gzl

DIOPT Version :10

Sequence 1:NP_726563.1 Gene:Rnf11 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_649653.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster


Alignment Length:69 Identity:25/69 - (36%)
Similarity:40/69 - (57%) Gaps:5/69 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KRIGLMQYLPIGTYDGSSKKARECVICMAEFCVNEAVRYLPCMHIYHVNCIDDWLLRS-LTCPSC 132
            |::.:::|    |.:.::.|...||||:.:|..::.:|.|||.|.||.:|||.||..: ..||.|
  Fly   216 KKLPVLRY----TKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCPIC 276

  Fly   133 LEPV 136
            ...|
  Fly   277 KRKV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf11NP_726563.1 RING-H2_RNF11 91..133 CDD:438131 19/42 (45%)
gzlNP_649653.1 PA_C_RZF_like 14..171 CDD:239038
RING-H2_RNF13-like 233..278 CDD:438327 20/44 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.