DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32850 and Znrf3

DIOPT Version :9

Sequence 1:NP_726563.1 Gene:CG32850 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001074393.1 Gene:Znrf3 / 407821 MGIID:3039616 Length:913 Species:Mus musculus


Alignment Length:48 Identity:20/48 - (41%)
Similarity:29/48 - (60%) Gaps:0/48 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 SSKKARECVICMAEFCVNEAVRYLPCMHIYHVNCIDDWLLRSLTCPSC 132
            ||....:|.||:.::...|.:|.:||.|.:|..|:|.|||:..|||.|
Mouse   283 SSGSTSDCAICLEKYIDGEELRVIPCTHRFHRKCVDPWLLQHHTCPHC 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32850NP_726563.1 zf-RING_2 91..132 CDD:290367 17/40 (43%)
Znrf3NP_001074393.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
zf-RING_2 289..331 CDD:290367 18/42 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 601..669
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 855..913
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.