DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32850 and rnf11a

DIOPT Version :9

Sequence 1:NP_726563.1 Gene:CG32850 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_957315.1 Gene:rnf11a / 393996 ZFINID:ZDB-GENE-040426-1277 Length:146 Species:Danio rerio


Alignment Length:153 Identity:81/153 - (52%)
Similarity:105/153 - (68%) Gaps:15/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNCLKISTSDDISLLRGNDSQ---ISGTQPVYHQGEHYQRELYPSTSSSTTLTPSSNNRQLSDE 62
            |||||....:||:|||  |:|:   :.|..|..:| |..|..:|..|.|.|.|.     .||::|
Zfish     1 MGNCLSSQGADDLSLL--NESEGASLPGEPPPPYQ-ERAQVPVYHPTPSQTRLA-----TQLTEE 57

  Fly    63 NQVKIAKRIGLMQYLPIGTYD----GSSKKARECVICMAEFCVNEAVRYLPCMHIYHVNCIDDWL 123
            .||:||:||||:|:||.|.:|    .|.||.:||||||.:|...:.:|:|||||||||:|||.||
Zfish    58 EQVRIAQRIGLIQHLPRGIFDPGSEPSDKKIKECVICMMDFEYGDPIRFLPCMHIYHVDCIDAWL 122

  Fly   124 LRSLTCPSCLEPVDAALLTSYES 146
            :||.|||||:||||||||:|||:
Zfish   123 MRSFTCPSCMEPVDAALLSSYET 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32850NP_726563.1 zf-RING_2 91..132 CDD:290367 27/40 (68%)
rnf11aNP_957315.1 Vinculin <10..>70 CDD:279395 28/67 (42%)
zf-RING_2 90..131 CDD:290367 27/40 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596533
Domainoid 1 1.000 79 1.000 Domainoid score I8628
eggNOG 1 0.900 - - E33208_3BJQA
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4234
OMA 1 1.010 - - QHG48953
OrthoDB 1 1.010 - - D1261762at2759
OrthoFinder 1 1.000 - - FOG0000414
OrthoInspector 1 1.000 - - otm24642
orthoMCL 1 0.900 - - OOG6_107826
Panther 1 1.100 - - O PTHR46359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3666
SonicParanoid 1 1.000 - - X150
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.