DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32850 and CG10916

DIOPT Version :9

Sequence 1:NP_726563.1 Gene:CG32850 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001261070.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster


Alignment Length:85 Identity:28/85 - (32%)
Similarity:40/85 - (47%) Gaps:10/85 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SNNRQLSDENQVKIAKRIGLMQYLPIGTYDGSSKKARECVICMAEFCVNEAV-RYLPCMHIYHVN 117
            ||:.:: :.|..|||:        ...|.|.|......|.||...|..|:.: ....|.|::|.:
  Fly     3 SNSSEM-EGNGGKIAE--------TAPTNDSSPSLNILCAICNEFFRANDIIFSTSRCGHVFHKD 58

  Fly   118 CIDDWLLRSLTCPSCLEPVD 137
            |:..||.||.|||.|.:|.|
  Fly    59 CLTRWLNRSRTCPQCRDPCD 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32850NP_726563.1 zf-RING_2 91..132 CDD:290367 16/41 (39%)
CG10916NP_001261070.1 zf-RING_2 32..74 CDD:290367 16/41 (39%)
zf-rbx1 <32..74 CDD:289448 16/41 (39%)
DM9 105..183 CDD:128937
DUF3421 133..246 CDD:288732
DM9 186..254 CDD:128937
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.