DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32850 and Rnf44

DIOPT Version :9

Sequence 1:NP_726563.1 Gene:CG32850 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:XP_006253695.1 Gene:Rnf44 / 361212 RGDID:1307212 Length:433 Species:Rattus norvegicus


Alignment Length:120 Identity:35/120 - (29%)
Similarity:58/120 - (48%) Gaps:28/120 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YPS---------TSSSTTLTPS-SNNRQLSD------ENQVKIAKRIG----------LMQYLPI 79
            |||         ..|.||:.|: |.:..:.|      |..:.:|:|:|          .::.||.
  Rat   302 YPSFLPYFLSMLPMSPTTVGPTISLDLDVDDVEMENYEALLNLAERLGDAKPRGLTKADIEQLPS 366

  Fly    80 GTYDGSSKKARE--CVICMAEFCVNEAVRYLPCMHIYHVNCIDDWLLRSLTCPSC 132
            ..::..|.::.:  ||:|.::|.|.:.:|.|||.|.:|..|:|.||..:.|||.|
  Rat   367 YRFNPDSHQSEQTLCVVCFSDFEVRQLLRVLPCNHEFHAKCVDKWLKANRTCPIC 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32850NP_726563.1 zf-RING_2 91..132 CDD:290367 18/42 (43%)
Rnf44XP_006253695.1 zf-RING_2 381..422 CDD:290367 19/41 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.