DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32850 and Rnf11l2

DIOPT Version :9

Sequence 1:NP_726563.1 Gene:CG32850 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:XP_006245372.1 Gene:Rnf11l2 / 316552 RGDID:1306139 Length:154 Species:Rattus norvegicus


Alignment Length:159 Identity:84/159 - (52%)
Similarity:109/159 - (68%) Gaps:19/159 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNCLKISTSDDISLLRGNDSQIS----GTQPVYHQGEHYQREL-----YPSTSSSTTLTPSSNN 56
            ||||||..||||||||..:.|..:    ||:|.......||.::     :|:.|.:...|     
  Rat     1 MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQARLAT----- 60

  Fly    57 RQLSDENQVKIAKRIGLMQYLPIGTY----DGSSKKARECVICMAEFCVNEAVRYLPCMHIYHVN 117
             ||::|.|::||:||||:|:||.|.|    |||.||.|||||||.:|...:.:|:||||||||::
  Rat    61 -QLTEEEQIRIAQRIGLIQHLPKGGYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLD 124

  Fly   118 CIDDWLLRSLTCPSCLEPVDAALLTSYES 146
            ||||||:||.|||||:||||||||:|||:
  Rat   125 CIDDWLMRSFTCPSCMEPVDAALLSSYET 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32850NP_726563.1 zf-RING_2 91..132 CDD:290367 27/40 (68%)
Rnf11l2XP_006245372.1 zf-RING_2 98..139 CDD:290367 27/40 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1261762at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.