DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32850 and RNF149

DIOPT Version :9

Sequence 1:NP_726563.1 Gene:CG32850 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:XP_005263977.1 Gene:RNF149 / 284996 HGNCID:23137 Length:428 Species:Homo sapiens


Alignment Length:109 Identity:37/109 - (33%)
Similarity:50/109 - (45%) Gaps:17/109 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HYQRELYPSTSSSTTLTPSSNNRQLSDENQVKIAKR-IG--LMQYLPIGTYDGSSKKARECVICM 96
            :.||.||..:             |:..::..|..|: ||  |:..:..|. .|....|..|.:|:
Human   223 YIQRFLYTGS-------------QIGSQSHRKETKKVIGQLLLHTVKHGE-KGIDVDAENCAVCI 273

  Fly    97 AEFCVNEAVRYLPCMHIYHVNCIDDWLLRSLTCPSCLEPVDAAL 140
            ..|.|.:.:|.|||.||:|..|||.|||...|||.|...|..||
Human   274 ENFKVKDIIRILPCKHIFHRICIDPWLLDHRTCPMCKLDVIKAL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32850NP_726563.1 zf-RING_2 91..132 CDD:290367 20/40 (50%)
RNF149XP_005263977.1 PA_GRAIL_like 43..185 CDD:239037
UPF0233 <204..>235 CDD:299753 5/24 (21%)
zf-RING_2 267..310 CDD:290367 20/42 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.