DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32850 and RNF11

DIOPT Version :9

Sequence 1:NP_726563.1 Gene:CG32850 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_055187.1 Gene:RNF11 / 26994 HGNCID:10056 Length:154 Species:Homo sapiens


Alignment Length:158 Identity:86/158 - (54%)
Similarity:108/158 - (68%) Gaps:17/158 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNCLKISTSDDISLLRGNDSQIS----GTQPVYHQGEHYQRE----LYPSTSSSTTLTPSSNNR 57
            ||||||..||||||||..:.|..:    ||:|.......||.:    :|..|.|.|.|.     .
Human     1 MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLA-----T 60

  Fly    58 QLSDENQVKIAKRIGLMQYLPIGTY----DGSSKKARECVICMAEFCVNEAVRYLPCMHIYHVNC 118
            ||::|.|::||:||||:|:||.|.|    |||.||.|||||||.:|...:.:|:||||||||::|
Human    61 QLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDC 125

  Fly   119 IDDWLLRSLTCPSCLEPVDAALLTSYES 146
            |||||:||.|||||:||||||||:|||:
Human   126 IDDWLMRSFTCPSCMEPVDAALLSSYET 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32850NP_726563.1 zf-RING_2 91..132 CDD:290367 27/40 (68%)
RNF11NP_055187.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 21/51 (41%)
PPxY motif 37..40 0/2 (0%)
RING-H2_RNF11 98..140 CDD:319382 28/41 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I8709
eggNOG 1 0.900 - - E33208_3BJQA
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32195
Inparanoid 1 1.050 165 1.000 Inparanoid score I4191
Isobase 1 0.950 - 0 Normalized mean entropy S2303
OMA 1 1.010 - - QHG48953
OrthoDB 1 1.010 - - D1261762at2759
OrthoFinder 1 1.000 - - FOG0000414
OrthoInspector 1 1.000 - - oto88888
orthoMCL 1 0.900 - - OOG6_107826
Panther 1 1.100 - - LDO PTHR46359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3666
SonicParanoid 1 1.000 - - X150
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.820

Return to query results.
Submit another query.