DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32850 and meu34

DIOPT Version :9

Sequence 1:NP_726563.1 Gene:CG32850 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_593329.1 Gene:meu34 / 2543036 PomBaseID:SPAC3A12.03c Length:309 Species:Schizosaccharomyces pombe


Alignment Length:63 Identity:22/63 - (34%)
Similarity:36/63 - (57%) Gaps:8/63 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CVICMAEFCVNEAVRYLPCMHIYHVNCIDDWL-LRSLTCPSCLE-------PVDAALLTSYES 146
            |:||.|::..::.:|.|||.|::|..|||.|: ....:||.|.|       .:|||...::|:
pombe   205 CIICYADYAFDDILRVLPCEHVFHTQCIDTWMTTMKASCPLCNEDYYKYFLQMDAASSVTHEN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32850NP_726563.1 zf-RING_2 91..132 CDD:290367 16/40 (40%)
meu34NP_593329.1 RING 205..249 CDD:238093 17/43 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000414
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X150
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.