powered by:
Protein Alignment CG32850 and meu34
DIOPT Version :9
Sequence 1: | NP_726563.1 |
Gene: | CG32850 / 318246 |
FlyBaseID: | FBgn0052850 |
Length: | 147 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_593329.1 |
Gene: | meu34 / 2543036 |
PomBaseID: | SPAC3A12.03c |
Length: | 309 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 63 |
Identity: | 22/63 - (34%) |
Similarity: | 36/63 - (57%) |
Gaps: | 8/63 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 92 CVICMAEFCVNEAVRYLPCMHIYHVNCIDDWL-LRSLTCPSCLE-------PVDAALLTSYES 146
|:||.|::..::.:|.|||.|::|..|||.|: ....:||.|.| .:|||...::|:
pombe 205 CIICYADYAFDDILRVLPCEHVFHTQCIDTWMTTMKASCPLCNEDYYKYFLQMDAASSVTHEN 267
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000414 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X150 |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.