DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32850 and RNF44

DIOPT Version :9

Sequence 1:	NP_726563.1	Gene:	CG32850 / 318246	FlyBaseID:	FBgn0052850	Length:	147	Species:	Drosophila melanogaster
Sequence 2:	NP_055716.1	Gene:	RNF44 / 22838	HGNCID:	19180	Length:	432	Species:	Homo sapiens

Alignment Length:	120	Identity:	33/120 - (27%)
Similarity:	56/120 - (46%)	Gaps:	28/120 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly    41 YPS---------TSSSTTLTPS-SNNRQLSD------ENQVKIAKRIG----------LMQYLPI 79
            |||         ..|.|.:.|: |.:..:.|      |..:.:|:|:|          .::.||.
Human   301 YPSFLPYFLSMLPMSPTAMGPTISLDLDVDDVEMENYEALLNLAERLGDAKPRGLTKADIEQLPS 365

  Fly    80 GTYDGSSKKARE--CVICMAEFCVNEAVRYLPCMHIYHVNCIDDWLLRSLTCPSC 132
            ..::..|.::.:  ||:|.::|...:.:|.|||.|.:|..|:|.||..:.|||.|
Human   366 YRFNPDSHQSEQTLCVVCFSDFEARQLLRVLPCNHEFHTKCVDKWLKANRTCPIC 420

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32850	NP_726563.1	zf-RING_2	91..132	CDD:290367	17/42 (40%)
RNF44	NP_055716.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..86
		RING-H2_RNF38_like	377..421	CDD:319386	18/44 (41%)
		RING-H2 finger (C3H2C3-type)	380..420	CDD:319386	17/39 (44%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910