DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf11 and Traip

DIOPT Version :10

Sequence 1:NP_726563.1 Gene:Rnf11 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_035764.2 Gene:Traip / 22036 MGIID:1096377 Length:470 Species:Mus musculus


Alignment Length:43 Identity:15/43 - (34%)
Similarity:20/43 - (46%) Gaps:2/43 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CVICMAEFCVNEAVRYLPCMHIYHVNCIDDWL--LRSLTCPSC 132
            |.||...|..:..|..:.|.|.:|:.|:..|.  ..|.|||.|
Mouse     7 CTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQC 49

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf11NP_726563.1 RING-H2_RNF11 91..133 CDD:438131 15/43 (35%)
TraipNP_035764.2 RING-H2_TRAIP 6..50 CDD:438143 15/43 (35%)
EnvC 65..>279 CDD:443969
Interaction with CYLD. /evidence=ECO:0000250|UniProtKB:Q9BWF2 211..470
PIP-box. /evidence=ECO:0000250|UniProtKB:Q9BWF2 461..470
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.