| Sequence 1: | NP_726563.1 | Gene: | Rnf11 / 318246 | FlyBaseID: | FBgn0052850 | Length: | 147 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_035764.2 | Gene: | Traip / 22036 | MGIID: | 1096377 | Length: | 470 | Species: | Mus musculus |
| Alignment Length: | 43 | Identity: | 15/43 - (34%) |
|---|---|---|---|
| Similarity: | 20/43 - (46%) | Gaps: | 2/43 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 92 CVICMAEFCVNEAVRYLPCMHIYHVNCIDDWL--LRSLTCPSC 132 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Rnf11 | NP_726563.1 | RING-H2_RNF11 | 91..133 | CDD:438131 | 15/43 (35%) |
| Traip | NP_035764.2 | RING-H2_TRAIP | 6..50 | CDD:438143 | 15/43 (35%) |
| EnvC | 65..>279 | CDD:443969 | |||
| Interaction with CYLD. /evidence=ECO:0000250|UniProtKB:Q9BWF2 | 211..470 | ||||
| PIP-box. /evidence=ECO:0000250|UniProtKB:Q9BWF2 | 461..470 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||