DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf11 and RNF13

DIOPT Version :10

Sequence 1:NP_726563.1 Gene:Rnf11 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_009213.1 Gene:RNF13 / 11342 HGNCID:10057 Length:381 Species:Homo sapiens


Alignment Length:91 Identity:29/91 - (31%)
Similarity:46/91 - (50%) Gaps:12/91 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LTPSSNNRQLSDENQVKIAKRIGLMQYLPIGTYDGSSKKARE---CVICMAEFCVNEAVRYLPCM 111
            :|....:|..:..|::    |...::.||:..:    ||..|   |.||:.|:...:.:|.|||.
Human   203 ITKFVQDRHRARRNRL----RKDQLKKLPVHKF----KKGDEYDVCAICLDEYEDGDKLRILPCS 259

  Fly   112 HIYHVNCIDDWLLRS-LTCPSCLEPV 136
            |.||..|:|.||.:: .|||.|.:.|
Human   260 HAYHCKCVDPWLTKTKKTCPVCKQKV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf11NP_726563.1 RING-H2_RNF11 91..133 CDD:438131 19/45 (42%)
RNF13NP_009213.1 PA_C_RZF_like 23..180 CDD:239038
RING-H2_RNF13 230..288 CDD:438450 23/60 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..381 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.