DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32850 and Rnf11l1

DIOPT Version :9

Sequence 1:NP_726563.1 Gene:CG32850 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001258153.1 Gene:Rnf11l1 / 100364162 RGDID:2321596 Length:154 Species:Rattus norvegicus


Alignment Length:158 Identity:86/158 - (54%)
Similarity:108/158 - (68%) Gaps:17/158 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNCLKISTSDDISLLRGNDSQIS----GTQPVYHQGEHYQRE----LYPSTSSSTTLTPSSNNR 57
            ||||||..||||||||..:.|..:    ||:|.......||.:    :|..|.|.|.|.     .
  Rat     1 MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLA-----T 60

  Fly    58 QLSDENQVKIAKRIGLMQYLPIGTY----DGSSKKARECVICMAEFCVNEAVRYLPCMHIYHVNC 118
            ||::|.|::||:||||:|:||.|.|    |||.||.|||||||.:|...:.:|:||||||||::|
  Rat    61 QLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDC 125

  Fly   119 IDDWLLRSLTCPSCLEPVDAALLTSYES 146
            |||||:||.|||||:||||||||:|||:
  Rat   126 IDDWLMRSFTCPSCMEPVDAALLSSYET 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32850NP_726563.1 zf-RING_2 91..132 CDD:290367 27/40 (68%)
Rnf11l1NP_001258153.1 RING-H2_RNF11 98..140 CDD:319382 28/41 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I8488
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32195
Inparanoid 1 1.050 165 1.000 Inparanoid score I4091
OMA 1 1.010 - - QHG48953
OrthoDB 1 1.010 - - D1261762at2759
OrthoFinder 1 1.000 - - FOG0000414
OrthoInspector 1 1.000 - - oto96020
orthoMCL 1 0.900 - - OOG6_107826
Panther 1 1.100 - - LDO PTHR46359
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X150
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.980

Return to query results.
Submit another query.