DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32850 and rnf11b

DIOPT Version :9

Sequence 1:NP_726563.1 Gene:CG32850 / 318246 FlyBaseID:FBgn0052850 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001121880.1 Gene:rnf11b / 100150568 ZFINID:ZDB-GENE-050913-69 Length:154 Species:Danio rerio


Alignment Length:159 Identity:82/159 - (51%)
Similarity:106/159 - (66%) Gaps:19/159 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNCLKISTSDDISLLRGNDSQIS----GTQPVYHQGEHYQREL-----YPSTSSSTTLTPSSNN 56
            ||||||..||||||||..:.|..:    ...|.......||.::     :|:.|.:...|     
Zfish     1 MGNCLKSPTSDDISLLHESQSDRASFGDANDPDQEPPPPYQEQIHVPVYHPTPSQARLAT----- 60

  Fly    57 RQLSDENQVKIAKRIGLMQYLPIGTY----DGSSKKARECVICMAEFCVNEAVRYLPCMHIYHVN 117
             ||::|.||:||:||||:|:||.|.|    ||:.||.|||||||.:|...:.:|:||||||||::
Zfish    61 -QLTEEEQVRIAQRIGLIQHLPKGVYDPGSDGTEKKIRECVICMMDFVYGDPIRFLPCMHIYHLD 124

  Fly   118 CIDDWLLRSLTCPSCLEPVDAALLTSYES 146
            ||||||:||.|||||:||||||||:|||:
Zfish   125 CIDDWLMRSFTCPSCMEPVDAALLSSYET 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32850NP_726563.1 zf-RING_2 91..132 CDD:290367 27/40 (68%)
rnf11bNP_001121880.1 RING-H2_RNF11 98..140 CDD:319382 28/41 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I8628
eggNOG 1 0.900 - - E33208_3BJQA
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32195
Inparanoid 1 1.050 158 1.000 Inparanoid score I4234
OMA 1 1.010 - - QHG48953
OrthoDB 1 1.010 - - D1261762at2759
OrthoFinder 1 1.000 - - FOG0000414
OrthoInspector 1 1.000 - - otm24642
orthoMCL 1 0.900 - - OOG6_107826
Panther 1 1.100 - - LDO PTHR46359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3666
SonicParanoid 1 1.000 - - X150
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.