DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and RNF185

DIOPT Version :9

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_689480.2 Gene:RNF185 / 91445 HGNCID:26783 Length:192 Species:Homo sapiens


Alignment Length:158 Identity:69/158 - (43%)
Similarity:106/158 - (67%) Gaps:7/158 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ESFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVIPVYARNDKR 77
            :|.:|||||||||::||:|:||||||||||:||:.|:|:..||||||:|:.|.||||:|.|....
Human    34 DSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTG 98

  Fly    78 QEDPRDKTPPRPTGIWSDYANDLELGLFSY------LLFGL-FFPYGALSSYLDMDEPLNPAADH 135
            |:|||:||||||.|...:..|......|.:      :.||: .||:|..::..::::...|.|..
Human    99 QQDPREKTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVP 163

  Fly   136 GIRDGQNETLLSKFFLYVAIMLIIYMIV 163
            |.....:|..||:.||:||::::.::::
Human   164 GTPQYVDEQFLSRLFLFVALVIMFWLLI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 51/77 (66%)
RING 17..60 CDD:238093 31/42 (74%)
RNF185NP_689480.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Required for ubiquitin ligase activity and protection against ER stress-induced cell death. /evidence=ECO:0000269|PubMed:27485036 29..80 31/45 (69%)
RING-HC_RNF185 38..80 CDD:319658 30/41 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..123 15/32 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152548
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.