DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and PEX10

DIOPT Version :9

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_010551.1 Gene:PEX10 / 851858 SGDID:S000002673 Length:337 Species:Saccharomyces cerevisiae


Alignment Length:56 Identity:18/56 - (32%)
Similarity:30/56 - (53%) Gaps:3/56 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ESFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVI 68
            |:..:|.:||....:...:.|||||||.||..|...:|:   ||:|:......:::
Yeast   281 EASRKCILCLMNMSDPSCAPCGHLFCWSCLMSWCKERPE---CPLCRQHCQPQEIL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 18/56 (32%)
RING 17..60 CDD:238093 17/42 (40%)
PEX10NP_010551.1 PEX10 5..337 CDD:227861 18/56 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.