Sequence 1: | NP_730026.1 | Gene: | CG32847 / 318245 | FlyBaseID: | FBgn0052847 | Length: | 164 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010551.1 | Gene: | PEX10 / 851858 | SGDID: | S000002673 | Length: | 337 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 56 | Identity: | 18/56 - (32%) |
---|---|---|---|
Similarity: | 30/56 - (53%) | Gaps: | 3/56 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 ESFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVI 68 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32847 | NP_730026.1 | PLN03208 | 4..>91 | CDD:178747 | 18/56 (32%) |
RING | 17..60 | CDD:238093 | 17/42 (40%) | ||
PEX10 | NP_010551.1 | PEX10 | 5..337 | CDD:227861 | 18/56 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5574 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |